General Information

  • ID:  hor005499
  • Uniprot ID:  P81032
  • Protein name:  Crustacean hyperglycemic hormone
  • Gene name:  NA
  • Organism:  Cancer pagurus (Rock crab)
  • Family:  arthropod CHH/MIH/GIH/VIH hormone family
  • Source:  animal
  • Expression:  Produced by the medulla terminalis X-organ in the eyestalks and transported to the sinus gland where they are stored and released.
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Cancer (genus), Cancridae (family), Cancroidea (superfamily), Heterotremata, Eubrachyura, Brachyura (infraorder), Pleocyemata (suborder), Decapoda (order), Eucarida (superorder), Eumalacostraca (subclass), Malacostraca (class), Multicrustacea (superclass), Crustacea (subphylum), Pancrustacea, Mandibulata, Arthropoda (phylum), Panarthropoda, Ecdysozoa, Protostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0005179 hormone activity; GO:0005184 neuropeptide hormone activity
  • GO BP:  GO:0005975 carbohydrate metabolic process; GO:0006006 glucose metabolic process; GO:0007218 neuropeptide signaling pathway
  • GO CC:  GO:0005576 extracellular region

Sequence Information

  • Sequence:  QIYDTSCKGVYDRGLFSDLEHVCDDCYNLYRNSYVASACRSNCYSNVVFRQCMEELLLMDEFDKYARAVQIV
  • Length:  72
  • Propeptide:  QIYDTSCKGVYDRGLFSDLEHVCDDCYNLYRNSYVASACRSNCYSNVVFRQCMEELLLMDEFDKYARAVQIV
  • Signal peptide:  NA
  • Modification:  T1 Pyrrolidone carboxylic acid;T72 Valine amide
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Control the blood sugar level. Has a secretagogue action over the amylase released from the midgut gland. May act as a stress hormone and may be involved in the control of molting and reproduction
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  7-43; 23-39; 26-52
  • Structure ID:  AF-P81032-F1(AlphaFold_DB_ID)

  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
    •    AF-P81032-F1.pdbhor005499_AF2.pdbhor005499_ESM.pdb

Physical Information

Mass: 970813 Formula: C366H556N98O116S8
Absent amino acids: PW Common amino acids: DVYCLS
pI: 4.43 Basic residues: 8
Polar residues: 26 Hydrophobic residues: 22
Hydrophobicity: -22.64 Boman Index: -14769
Half-Life: 0.8 hour Half-Life Yeast: 10 min
Half-Life E.Coli: >10 hour Aliphatic Index 77.08
Instability Index: 4042.78 Extinction Coefficient cystines: 10805
Absorbance 280nm: 152.18

Literature

  • PubMed ID:  9809792
  • Title:  Amino acid sequences of both isoforms of crustacean hyperglycemic hormone (CHH) and corresponding precursor-related peptide in Cancer pagurus.